General Information

  • ID:  hor005815
  • Uniprot ID:  P83856
  • Protein name:  Bradykinin
  • Gene name:  NA
  • Organism:  Gadus morhua (Atlantic cod)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Gadus (genus), Gadidae (family), Gadoidei (suborder), Gadiformes (order), Gadariae , Zeiogadaria , Paracanthopterygii , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004869 cysteine-type endopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity
  • GO BP:  GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  NA

Sequence Information

  • Sequence:  RPPGWSPLR
  • Length:  9
  • Propeptide:  RHEVPQANLECDEGAMDLKISTGNMVALYQILSASKDSDCPAGGAVTWTDQVVAGLRICMGCPVELDLESEELKVPVAVSISKRRPPGWSPLRAAVTSFNEKEFSPPAPPSRAEYSLYFDMRK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits papain and ficin (cysteine proteinases) but not trypsin (a serine proteinase).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P83856-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005815_AF2.pdbhor005815_ESM.pdb

Physical Information

Mass: 120810 Formula: C49H76N16O11
Absent amino acids: ACDEFHIKMNQTVY Common amino acids: P
pI: 12.5 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -134.44 Boman Index: -2505
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 43.33
Instability Index: 13562.22 Extinction Coefficient cystines: 5500
Absorbance 280nm: 687.5

Literature

  • PubMed ID:  12047371
  • Title:  Purification and characterization of novel kininogens from spotted wolffish and Atlantic cod.